Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Ephrin-A4, Active, Recombinant, Human, His-hFc-Tag, aa26-171 (EFNA4)

Product Sizes
10ug
£384.00
586875-10UG
About this Product
SKU:
586875
Extra Details:
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Partial recombinant protein corresponding to aa26-171 from human Ephrin-A4, fused to 6xHis-hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~44.3kD Biological Activity: The ED50 as determined by its ability to bind human EphA7 in functional ELISA is less than 10ug/ml. Amino Acid Sequence: LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight:
44.3
Physical State:
Supplied as a lyophilized powder from PBS, pH 7.2. Reconstitute with sterile ddH2O to 0.1-1mg/ml.
Purity:
≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C
Supplier:
United States Biological
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins