Ephrin-A4, Active, Recombinant, Human, His-hFc-Tag, aa26-171 (EFNA4)
Product Sizes
10ug
£384.00
586875-10UG
About this Product
- SKU:
- 586875
- Extra Details:
- Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Partial recombinant protein corresponding to aa26-171 from human Ephrin-A4, fused to 6xHis-hFc-Tag at C-terminal, expressed in Mammalian cells. Molecular Weight: ~44.3kD Biological Activity: The ED50 as determined by its ability to bind human EphA7 in functional ELISA is less than 10ug/ml. Amino Acid Sequence: LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molecular Weight:
- 44.3
- Physical State:
- Supplied as a lyophilized powder from PBS, pH 7.2. Reconstitute with sterile ddH2O to 0.1-1mg/ml.
- Purity:
- ≥95% (SDS-PAGE) Endotoxin: ≤1EU/ug (LAL)
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins
