Zinc Finger Protein GLI1, Recombinant, Human, aa921-1106, His-Tag
Product Sizes
20ug
£499.00
586820-20UG
About this Product
- SKU:
- 586820
- Extra Details:
- Acts as a transcriptional activator. Binds to the DNA consensus sequence 5'-GACCACCCA-3'. Regulates the transcription of specific genes during normal development. Plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling. Plays a role in cell proliferation and differentiation via its role in SHH signaling.; Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration. Source: Recombinant protein corresponding to aa921-1106 from human Zinc finger protein GLI1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.3kD Amino Acid Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molecular Weight:
- 23.3
- Physical State:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Purity:
- ≥90% (SDS-PAGE)
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules
