Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Iron-sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, Recombinant, Human, aa35-167, His-Tag

Product Sizes
20ug
£499.00
585083-20UG
About this Product
SKU:
585083
Extra Details:
Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic Functions as a cytoplasmic scaffold protein for the de novo synthesis of iron-sulfur clusters in the cytoplasm. Source: Recombinant protein corresponding to aa35-167 from human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.0kD Amino Acid Sequence: YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight:
18
Physical State:
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity:
≥85% (SDS-PAGE)
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C
Supplier:
United States Biological
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins