HLA Class II Histocompatibility Antigen, DRB1-12 Beta Chain, Recombinant, Human, aa31-266, His-Tag
Product Sizes
20ug
£499.00
584862-20UG
About this Product
- SKU:
- 584862
- Extra Details:
- Source: Recombinant protein corresponding to aa31-266 from human HLA class II histocompatibility antigen, DRB1-12 beta chain, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~30.9kD Amino Acid Sequence: DTRPRFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGAVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molecular Weight:
- 30.9
- Physical State:
- Supplied as a liquid in Tris, 50% glycerol
- Purity:
- ≥90% (SDS-PAGE)
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins
