Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout

E3 Ubiquitin-protein Ligase ZNRF3, Recombinant, Human, aa56-219, His-SUMO-Tag

Product Sizes
20ug
£499.00
584339-20UG
About this Product
SKU:
584339
Extra Details:
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification. Source: Recombinant protein corresponding to aa56-219 from human E3 ubiquitin-protein ligase ZNRF3, fused to 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~34.2kD Amino Acid Sequence: KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight:
34.2
Physical State:
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity:
≥90% (SDS-PAGE)
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C
Supplier:
United States Biological
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules