Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

ATP-sensitive inward Rectifier Potassium Channel 10, Recombinant, Human, aa165-379, His-SUMO-Tag

Product Sizes
20ug
£499.00
583722-20UG
About this Product
SKU:
583722
Extra Details:
May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules. Source: Recombinant protein corresponding to aa165-379 from human ATP-sensitive inward rectifier potassium channel 10, Recombinant, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~39.8kD Amino Acid Sequence: FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight:
39.8
Physical State:
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity:
≥90% (SDS-PAGE)
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C
Supplier:
United States Biological
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins