F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (Caf1)
Product Sizes
20ug
£570.00
372536-20UG
About this Product
- SKU:
- 372536
- Extra Details:
- Full length recombinant protein corresponding to aa22-170 from yersinia pestis F1 Capsule Antigen, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/Uniprot Accession: P26948 Molecular Weight: ~17.6kD Amino Acid Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molecular Weight:
- 17.6
- Physical State:
- Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Purity:
- ≥90% (SDS-PAGE)
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins
