OPA1 (Pptic Atrophy 1 (Autosomal Dominant), FLJ12460, KIAA0567, MGM1, NPG, NTG, LargeG)
Product Sizes
100ug
£685.00
249604-100UG
About this Product
- SKU:
- 249604
- Application:
- Western Blot
- translate.label.attr.clone:
- 8A20
- Clonality:
- Monoclonal
- Extra Details:
- This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa851-890 from human OPA1 with GST tag. MW of the GST tag alone is 26kD.
- Isotype:
- IgG2a,k
- Physical State:
- Supplied as a liquid in PBS, pH 7.4.
- Purity:
- Purified
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human OPA1.Species Crossreactivity: rat
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Monoclonal Antibody
