Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Assay Kits & ELISAs

Procollagen C Proteinase Enhancer 2 (PCPE2) Recombinant, Human

Product Sizes
10ug
£412.00
156450-10UG
About this Product
SKU:
156450
Extra Details:
Source: Recombinant Human from E. coli Accession No: Q9UKZ9 Fragment: Cys297~Cys415 (Accession No: Q9UKZ9) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-CQQK CRRTGTLEGN YCSSDFVLAG TVITTITRDG SLHATVSIIN IYKEGNLAIQ QAGKNMSARL TVVCKQCPLL RRGLNYIIMG QVGEDGRGKI MPNSFIMMFK TKNQKLLDAL KNKQC Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 18.9kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Molecular Weight:
18.9
Physical State:
Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
Purity:
≥95%
Shipping Conditions:
Blue Ice
Storage Conditions:
4[o]C/-70[o]C
Supplier:
United States Biological
Type:
Assay Kits:Collagen