Hepcidin (Hepc) Recombinant, Mouse, Thr24~Thr83
Product Sizes
10ug
£369.00
155040-10UG
About this Product
- SKU:
- 155040
- Extra Details:
- Source: Recombinant Mouse from E. coli Accession No: Q9EQ21 Fragment: Thr24~Thr83 (Accession No: Q9EQ21) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-TYLHQQM RQTTELQPLH GEESRADIAI PMQKRRKRDT NFPICIFCCK CCNNSQCGIC CKT Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 12.7kD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Molecular Weight:
- 12.7
- Physical State:
- Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
- Purity:
- ≥95%
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 4[o]C/-70[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules:Recombinant Proteins
