TMED4 (Transmembrane emp24 Domain-containing Protein 4, Endoplasmic Reticulum Stress-response Protein 25, ERS25, GMP25iso, Putative NF-kappa-B-activating Protein 156, p24 Family Protein alpha-3, p24alpha3, ERS25)
Product Sizes
100ul
£744.00
138440-100UL
About this Product
- SKU:
- 138440
- Application:
- Western Blot, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- N-terminus of TMED4 corresponding to LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human TMED4.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
