SLC6A18 (Sodium-dependent Neutral Amino Acid Transporter B(0)AT3, Sodium- and Chloride-dependent Transporter XTRP2, Solute Carrier Family 6 Member 18, System B(0) Neutral Amino Acid Transporter AT3, XTRP2, FLJ31236)
Product Sizes
100ul
£744.00
138381-100UL
About this Product
- SKU:
- 138381
- Application:
- Western Blot, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- The SLC6 family of proteins, which includes SLC6A18, acts as specific transporters for neurotransmitters, aa, and osmolytes like betaine, taurine, and creatine. SLC6 proteins are sodium cotransporters that derive the energy for solute transport from the electrochemical gradient for sodium ions. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Middle region of SLC6A18 corresponding to MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes SLC6A18. Species Crossreactivity: Human, mouse and rat.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Type:
- Antibodies:Polyclonal Antibody
