SLC38A4 (Sodium-coupled Neutral Amino Acid Transporter 4, Amino Acid Transporter A3, Na(+)-coupled Neutral Amino Acid Transporter 4, Solute Carrier Family 38 Member 4, System A Amino Acid Transporter 3, System N Amino Acid Transporter 3, ATA3, NAT3, SNAT4)
Product Sizes
100ul
£744.00
138375-100UL
About this Product
- SKU:
- 138375
- Application:
- Western Blot, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- SLC38A4 is found predominantly in liver and transports both cationic and neutral aa. The transport of cationic aa by SLC38A4 is Na(+) and pH independent, while the transport of neutral aa is Na(+) and pH dependent. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Middle region of SLC38A4 corresponding to LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes SLC38A4. Species Crossreactivity: Human, mouse, rat, canine, c. elegans, drosophila, and zebrafish.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Type:
- Antibodies:Polyclonal Antibody
