SLC36A3 (Proton-coupled Amino Acid Transporter 3, Proton/Amino Acid Transporter 3, Solute Carrier Family 36 Member 3, Tramdorin-2, PAT3, TRAMD2, FLJ16658, MGC119638, MGC119639, MGC119641)
Product Sizes
100ul
£744.00
138372-100UL
About this Product
- SKU:
- 138372
- Application:
- Western Blot, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- The function of SLC36A3 protein is not widely studied, and is yet to be elucidated fully. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human SLC36A3.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Type:
- Antibodies:Polyclonal Antibody
