SGCG (Gamma-sarcoglycan, Gamma-SG, 35kD Dystrophin-associated Glycoprotein, 35DAG, MGC130048, LGMD2C, TYPE)
Product Sizes
100ul
£744.00
138335-100UL
About this Product
- SKU:
- 138335
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes SGCG. Species Crossreactivity: Human, mouse, rat and canine.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
