PDSS1 (Decaprenyl-diphosphate Synthase Subunit 1, All-trans-decaprenyl-diphosphate Synthase Subunit 1, Decaprenyl Pyrophosphate Synthase Subunit 1, Trans-prenyltransferase 1, TPT 1, DPS1, TPRT, COQ1, DPS, MGC70953, RP13-16H11.3, SPS, TPT)
Product Sizes
100ul
£744.00
138213-100UL
About this Product
- SKU:
- 138213
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes PDSS1. Species Crossreactivity: Human and mouse.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
