NSUN5C (NSUN5P2, WBSCR20B, WBSCR20C, Putative Methyltransferase NSUN5C, NOL1/NOP2/Sun Domain Family Member 5C, Williams-Beuren Syndrome Chromosomal Region 20C Protein, DKFZp434K058, DKFZp666P104, FLJ11626, MGC129801, MGC15057)
Product Sizes
100ul
£744.00
138195-100UL
About this Product
- SKU:
- 138195
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Middle region of NSUN5C corresponding to PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human NSUN5C.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
