NR1I3 (CAR, Nuclear Receptor Subfamily 1 Group I Member 3, Constitutive Activator of Retinoid Response, Constitutive Androstane Receptor, Orphan Nuclear Receptor MB67)
Product Sizes
100ul
£744.00
138192-100UL
About this Product
- SKU:
- 138192
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- N-terminus of NR1I3 corresponding to MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human NR1I3.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
