NR1H2 (Oxysterols Receptor LXR-beta, Liver X Receptor beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Ubiquitously-expressed Nuclear Receptor, LXRB, NER, UNR)
Product Sizes
100ul
£744.00
138191-100UL
About this Product
- SKU:
- 138191
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA) and beta, are known to encode LXR proteins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Middle region of NR1H2 corresponding to MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes NR1H2. Species Crossreactivity: Human, mouse, rat and canine.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
