CLIC2 (Chloride Intracellular Channel Protein 2, XAP121, CLIC2b)
Product Sizes
100ul
£744.00
137855-100UL
About this Product
- SKU:
- 137855
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- C-terminus of CLIC2 corresponding to SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes CLIC2. Species Crossreactivity: Human, rat, and canine.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
