CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP)
Product Sizes
100ul
£744.00
137823-100UL
About this Product
- SKU:
- 137823
- Application:
- Western Blot, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes CDH3. Species Crossreactivity: Human and mouse.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
