ACCN3 (ASIC3, SLNAC1, TNAC1, Acid-sensing Ion Channel 3, Amiloride-sensitive Cation Channel 3, Neuronal Amiloride-sensitive Cation Channel 3, Testis Sodium Channel 1, DRASIC)
Product Sizes
100ul
£744.00
137514-100UL
About this Product
- SKU:
- 137514
- Application:
- Western Blot, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. Applications: Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL corresponding to ACCN3.
- Isotype:
- IgG
- Physical State:
- Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
- Purity:
- Purified by affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human ACCN3.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Polyclonal Antibody
