RBM39 (HCC1, RNPC2, RNA-binding Protein 39, Hepatocellular Carcinoma Protein 1, RNA-binding Motif Protein 39, RNA-binding Region-containing Protein 2, Splicing Factor HCC1) (Biotin)
Product Sizes
100ul
£914.00
132396-BIOTIN-100UL
About this Product
- SKU:
- 132396-BIOTIN
- Application:
- Western Blot, Immunohistochemistry, Immunofluorescence
- translate.label.attr.clone:
- 4G8
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa423-472 from human RBM39 with GST tag. MW of the GST tag alone is 26kD.
- Isotype:
- IgG2a,k
- Physical State:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Purity:
- Purified by Protein A affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human RBM39. Species Crossreactivity: mouse.
- Source:
- human
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Antibodies:Monoclonal Antibody
