C4B (Complement C4-B, Basic Complement C4, C3 and PZP-like alpha-2-macroglobulin Domain-containing Protein 3, CO4, CPAMD3) (MaxLight 490)
Product Sizes
100ul
£914.00
124132-ML490-100UL
About this Product
- SKU:
- 124132-ML490
- Application:
- Western Blot, FLISA
- translate.label.attr.clone:
- 2E3
- Clonality:
- Monoclonal
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. C4 plays a central role in the activation of the classical pathway of the complement system. It is processed by activated C1 which removes from the alpha chain the C4a anaphylatoxin. The remaining alpha chain fragment C4b is the major activation product and is an essential subunit of the C3 convertase (C4b2a) and the C5 convertase (C3bC4b2a) enzymes of the classical complement pathway. Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1347-1446 from human C4B with GST tag. MW of the GST tag alone is 26kD.
- Isotype:
- IgG2b,k
- Physical State:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with MaxLight™490.
- Purity:
- Purified by Protein A affinity chromatography.
- Shipping Conditions:
- Blue Ice
- Specificity:
- Recognizes human C4B.
- Source:
- human
- Storage Conditions:
- 4[o]C Do Not Freeze
- Supplier:
- United States Biological
- Type:
- Antibodies:Monoclonal Antibody
