Transforming Growth Factor beta-1 Proprotein (TGFB1), Recombinant, Human, Active, aa279-390
Product Sizes
10ug
£384.00
059382-10UG
About this Product
- SKU:
- 059382
- Extra Details:
- Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts (By similarity). Stimulates sustained production of collagen through the activation of CREB3L1 by regulated intramembrane proteolysis (RIP). Partial recombinant protein corresponding to aa279-390 from human Transforming growth factor beta-1 protein, expressed in Mammalian cell. Swiss/Uniprot Accession: P01137 Molecular Weight: ~12.8kD Biological Acitivty: Measured in a cell inhibition assay using TF-1 cells at IL4 presence, the ED50 for this effect is ≤0.1ng/ml. Amino Acid Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Molecular Weight:
- 12.8
- Physical State:
- Supplied as a lyophilized powder from 100mM Glycine, pH 7.4, 5% mannitol, 0.01% Tween 80. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Purity:
- ≥95% (SDS-PAGE). Endotoxin: ≤10EU/ug (LAL).
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules
