Matrix Metalloproteinase 9 (MMP9), Recombinant, Rabbit, His-Tag
Product Sizes
10ug
£388.00
049230-10UG
About this Product
- SKU:
- 049230
- Application:
- Western Blot
- Extra Details:
- Recombinant protein corresponding to aa225-390 with an N-terminal His-Tag from raabbit MMP9, expressed in E. coli. Uniprot/Accession: P41246 Predicted Isoelectric Point: 5.0 Predicted Molecular Mass: 22.03kD Accurate Molecular Mass: 20kD as determined by SDS-PAGE reducing conditions Subcellular Location: Secreted, Extracellular matrix Amino Acid Sequence: ADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGN ADGKPCEFPFIFQGRTYSACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGN SAGELCVFPFVFLGKEYSSCTSEGRRDGRLWCATTSNFDSDKKWGFCPD Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0.. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
- Molecular Weight:
- 22
- Physical State:
- Supplied as lyophilized powder from 20mM Tris, 150mM sodium chloride, pH 8.0, 0.01% sarcosyl, 5% trehalose. Reconstitute with sterile 20mM Tris, 150mM sodium chloride, pH 8.0 to a concentration of 0.1
- Purity:
- ≥95%.
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- United States Biological
- Type:
- Assay Kits:MMP
