Alpha Synuclein Pre-formed Fibrils: Biotinylated (C-terminus)
Product Sizes
100 ug
SPR-508-100UG
2 x 100 ug
SPR-508-2X100UG
500 ug
SPR-508-500UG
About this Product
- SKU:
- SPR-508
- Additional Names:
- Alpha-synuclein, Alpha synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, PARK1, SYN, PD1, PARK4, Synuclein Alpha, Parkinson's disease familial 1 Protein, Biotin Alpha Synuclein , Asyn, Alpha Synuclein PFFs
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- Conjugate:
- Biotin
- Extra Details:
- Alpha-synuclein (A Alpha-synuclein), a neuronal protein encoded by the SNCA gene, plays a central role in synaptic function and is a key pathological driver in Parkinson's disease and related synucleinopathies. Aggregation of A Alpha-synuclein into fibrillar structures is a hallmark of disease progression, contributing to the formation of Lewy bodies and neuronal dysfunction. Biotinylated A Alpha-synuclein pre-formed fibrils (PFFs) are chemically tagged with biotin, enabling precise detection, immobilization, and tracking in experimental systems. These modified fibrils retain the structural and functional characteristics of native A Alpha-synuclein aggregates, making them highly valuable for studying the mechanisms of fibril propagation, cellular uptake, and seeding of endogenous A Alpha-synuclein. In neurodegenerative disease models, biotinylated PFFs facilitate high-resolution analysis of intercellular transmission, aggregate-induced toxicity, and protein clearance pathways. Their compatibility with streptavidin-based imaging and capture techniques allows for enhanced visualization and quantification of pathological processes in vitro and in vivo. Biotinylated A Alpha-synuclein PFFs serve as a robust platform for screening therapeutic candidates aimed at inhibiting fibril formation, blocking propagation, and restoring neuronal health. Their use accelerates translational research by providing reproducible and disease-relevant tools for understanding the molecular basis of synucleinopathies. A 15 amino acid tag on the C-terminal tail of Alpha Synuclein facilitates site-specific covalent biotinylation (1).
- Immunogen:
- Alpha Synuclein PFFs
- Molecular Weight:
- 16.27 kDa
- Purity:
- >95% based on SDS-PAGE and nanodrop analysis.
- Purification:
- Ion Exchange
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
