Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers
Product Sizes
100 ug
£484.00
SPR-533-100UG
2 x 100 ug
£812.00
SPR-533-2X100UG
5 x 100 ug
£1615.00
SPR-533-5X100UG
About this Product
- SKU:
- SPR-533
- Additional Names:
- AB Beta 1-40-Cys, AB40-C, Amyloid beta 1-40-C, Beta-amyloid peptide (1-40) with cysteine, APP40-Cys, BAPP40-Cys, Modified AB Beta40, Amyloid-beta (A4) precursor protein, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide (CVAP), Protease nexin-II (PN-II)
- Application:
- SDS-PAGE, Western Blot
- Buffer:
- PB pH7.4, 10mM NaCl
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Concentration:
- 1 mg/ml
- Extra Details:
- Amyloid Beta Peptide 1-40 (AB Beta40) is a predominant 40-residue isoform generated from proteolytic cleavage of the amyloid precursor protein (APP) and is widely studied for its contribution to Alzheimer's disease (AD) pathology. Although AB Beta40 aggregates more slowly than AB Beta42, it remains a key driver of early oligomerization, membrane interactions, and oxidative stress, all of which contribute to synaptic dysfunction and neurodegeneration. AB Beta40 also participates in liquid-liquid phase separation and membrane-assisted aggregation pathways, highlighting its mechanistic relevance to amyloid fibril formation and cellular toxicity. C-terminal modifications of AB Beta40 provide insight into structure-function relationships, as cysteine substitutions in terminal regions do not disrupt fibril architecture and can serve as strategic handles for biochemical labeling and structural interrogation. Studies using cysteine-modified AB Beta40 variants demonstrate that terminal residues remain solvent-exposed and amenable to thiol-reactive conjugation, supporting their utility in mechanistic aggregation studies. StressMarq's AB Beta40 + C-terminal Cysteine Monomers exploit this property by incorporating a C-terminal cysteine specifically designed for maleimide-based conjugation. This enables researchers to attach fluorophores, biotin, spin labels, nanoparticles, or crosslinkers without perturbing the core amyloidogenic region, providing a powerful platform for tracking monomer behavior, quantifying aggregation kinetics, and visualizing early oligomerization events. The monomers appear as a single band at the expected molecular weight on SDS-PAGE and Western blot, enabling reproducibility and consistency across assays. By pairing the biological relevance of AB Beta40 with a strategically engineered cysteine residue, AB Beta40-Cys monomers significantly enhance experimental precision in AD research-supporting studies on aggregation mechanisms, membrane interactions, neurotoxicity, biomarker development, and therapeutic screening.
- Immunogen:
- Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers
- Molecular Weight:
- 4.5 kDa
- Purity:
- >95%
- Sequence:
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic
