Human Recombinant Tau (K18) Wild-Type PFFs
Product Sizes
100 ug
£446.00
SPR-525-100UG
2 x 100 ug
£744.00
SPR-525-2X100UG
5 x 100 ug
£1471.00
SPR-525-5X100UG
About this Product
- SKU:
- SPR-525
- Additional Names:
- Tau K18, K18 Tau, Tau microtubule-binding repeat domain, Tau 4-repeat domain, Tau 4R fragment, Tau repeat domain (Tau-RD), Tau MTBR (microtubule-binding region), Recombinant Tau K18 fragment, Tau K18 fibril-forming fragment, Tau PFFs
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- 10 mM HEPES pH 7.4, 100 mM NaCl
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Concentration:
- 2 mg/ml
- Extra Details:
- Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein into insoluble fibrils that disrupt neuronal function. The K18 fragment, which includes the four microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. Kumar & Udgaonkar (2022) observed that tau K18 wildtype fibrils exhibit distinct structural features compared to mutant forms, with the wildtype fibrils catalyzing aggregation of monomeric tau more efficiently. StressMarq's Human Recombinant Tau (K18) Wild-Type Pre-Formed Fibrils have been demonstrated to seed monomers in an in-vitro ThT seeding assay.
- Immunogen:
- Tau (K18) Wild-Type PFFs
- Molecular Weight:
- 15.18 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLKDFDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-k18-wild-type-pre-formed-fibrils-spr-525/
