Human Recombinant Tau (K18) Wild-Type Monomers
Product Sizes
100 ug
£441.00
SPR-524-100UG
2 x 100 ug
£735.00
SPR-524-2X100UG
5 x 100 ug
£1452.00
SPR-524-5X100UG
About this Product
- SKU:
- SPR-524
- Additional Names:
- Tau K18, K18 Tau, Tau microtubule-binding repeat domain, Tau 4-repeat domain, Tau 4R fragment, Tau repeat domain (Tau-RD), Tau MTBR (microtubule-binding region), Recombinant Tau K18 fragment, Tau K18 fibril-forming fragment
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- 10 mM HEPES pH 7.4, 100 mM NaCl
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Concentration:
- 2 mg/ml
- Extra Details:
- Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein into insoluble fibrils that disrupt neuronal function. The K18 fragment, which includes the four microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. This fragment retains key aggregation-prone hexapeptide motifs that drive B Beta-sheet formation and fibrillization. StressMarq's Human Recombinant Tau (K18) Wild-Type Monomers have been demonstrated to form fibrils in the presence of heparin or when seeded with fibrils.
- Immunogen:
- Tau (K18) Wild-Type Monomers
- Molecular Weight:
- 15.18 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLKDFDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-k18-wild-type-monomers-spr-524/
