Human Recombinant Tau (K18) P301L Mutant Pre-Formed Fibrils (fibrillized without heparin)
Product Sizes
100 ug
£446.00
SPR-523-100UG
2 x 100 ug
£744.00
SPR-523-2X100UG
5 x 100 ug
£1471.00
SPR-523-5X100UG
About this Product
- SKU:
- SPR-523
- Additional Names:
- Tau K18 P301L, K18-P301L Tau, Tau 4R repeat domain P301L, Tau MTBR P301L, Tau microtubule-binding region P301L, Tau repeat domain P301L (Tau-RD P301L), Tau K18 mutant P301L, Recombinant Tau K18 P301L fragment, Tau 4-repeat construct P301L, Tau RD(P301L), Tau K18 familial FTDP-17 mutant, Tau PFFs
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- 10mM HEPES pH 7.4, 100mM NaCl
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Concentration:
- 2 mg/ml
- Extra Details:
- Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein. The K18 fragment, comprising the microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. The P301L mutation, located within the repeat domain, has been demonstrated to increase the protein's propensity to aggregate and seed, making it a key variant in modeling tau pathology. StressMarq's Tau (K18) P301L Mutant Pre-formed Fibrils are fibrillized without heparin and have been demonstrated to be neurotoxic to primary mouse cortical neurons.
- Immunogen:
- Tau (K18) P301L PFFs
- Molecular Weight:
- 15.2 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVLGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-k18-p301l-mutant-pre-formed-fibrils-spr-523/
