Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Alpha Synuclein S129A Mutant Pre-formed Fibrils

Product Sizes
100 ug
SPR-506-100UG
2 x 100 ug
SPR-506-2X100UG
5 x 100 ug
SPR-506-5X100UG
About this Product
SKU:
SPR-506
Additional Names:
Alpha-synuclein, Alpha synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, PARK1, SYN, PD1, PARK4, Synuclein Alpha, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A, Asyn, Alpha Synuclein PFFs
Application:
Cell-based/Functional Assay, Western Blot
Buffer:
1X PBS pH7.4
CE/IVD:
RUO
Concentration:
2 mg/ml
Extra Details:
Alpha-synuclein (A Alpha-synuclein), a neuronal protein encoded by the SNCA gene, plays a central role in synaptic function and is a key driver of pathology in Parkinson's disease and related synucleinopathies. Phosphorylation at serine 129 (S129) is a prominent post-translational modification observed in aggregated A Alpha-synuclein within Lewy bodies. The S129A mutation replaces serine with alanine, effectively blocking phosphorylation at this site and enabling researchers to study its functional impact. Pre-formed fibrils (PFFs) generated from S129A mutant monomers exhibit distinct structural and biochemical properties compared to wild-type fibrils. These phosphorylation-null fibrils allow for precise investigation into the role of S129 phosphorylation in aggregation, seeding, and neurotoxicity. In cellular and animal models, S129A PFFs induce A Alpha-synuclein pathology while bypassing phosphorylation-dependent signaling pathways, offering insights into alternative mechanisms of disease progression. S129A mutant PFFs are instrumental in dissecting the molecular basis of A Alpha-synuclein aggregation, intercellular transmission, and neuronal dysfunction. Their use supports the development of targeted therapies aimed at modulating post-translational modifications, inhibiting fibril formation, and enhancing protein clearance. By modeling a phosphorylation-resistant form of A Alpha-synuclein, S129A mutant PFFs provide a powerful platform for advancing neurodegenerative disease research and accelerating therapeutic discovery for Parkinson's disease and other A Alpha-synucleinopathies.
Immunogen:
Alpha Synuclein S129A PFFs
Molecular Weight:
14.44 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
TEM of human alpha synuclein S129A fibrils (SPR-506). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
SDS-PAGE of purified human alpha synuclein S129A fibrils (SPR-506) on a 12% Bis-Tris Gel. 2ug and 4ug of total protein were loaded into the respective lanes. Electrophoresis was run at 200V for 45 minutes with fixed voltage using 1X MES running buffer.
Seeding activity of human alpha synuclein S129A mutant measured by ThT in vitro. Human alpha synuclein S129A fibrils (SPR-506) will rapidly seed both wild-type and S129A alpha synuclein monomers (SPR-505) with comparable activity to wild-type fibrils.
Sedimentation assay of human alpha synuclein S129A fibrils (SPR-506) showing >90% of material is insoluble when spun at 20,000 xg. Lane 1: Biorad All Blue Standards (3uL), Lanes 2-4: human alpha synuclein S129A pre-formed fibrils (10ug) supernatant, wash and pellet.
TEM of human alpha synuclein S129A fibrils (SPR-506). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 100 nm.