Alpha Synuclein S129A Mutant Monomers
Product Sizes
100 ug
SPR-505-100UG
2 x 100 ug
SPR-505-2X100UG
5 x 100 ug
SPR-505-5X100UG
About this Product
- SKU:
- SPR-505
- Additional Names:
- Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A
- Application:
- Cell-based/Functional Assay, Western Blot
- CE/IVD:
- RUO
- Concentration:
- 2 mg/ml
- Extra Details:
- Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein has long been considered a hallmark of Parkinson's disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains (reviewed in [1]). Further, pS129 was recently shown to function as a physiological regulator of neuronal activity (2). Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129, and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm induction of endogenous pS129 pathology in disease models.
- Immunogen:
- Alpha Synuclein S129A
- Molecular Weight:
- 14.44 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/proteins/alpha-synuclein-s129a-mutant-monomers-spr-505/



