Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Tau dGAE (297-391) AD-mimic Pre-formed Fibrils

Product Sizes
100 ug
SPR-502-100UG
2 x 100 ug
SPR-502-2X100UG
500 ug
SPR-502-500UG
About this Product
SKU:
SPR-502
Additional Names:
Tau dGAE, Tau 297-391, Truncated Tau, Tau fragment 297-391, microtubule-associated tau, MAPT, MAP, Tau-441, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, Tau PFFs
Application:
Cell-based/Functional Assay, Western Blot
Buffer:
10mM PB pH 7.4, 10mM DTT, 200mM MgCl2
CE/IVD:
RUO
Extra Details:
Tau dGAE (297-391) represents a truncated segment of the microtubule-associated protein tau, encompassing the core region responsible for pathological aggregation. This fragment includes the repeat domains critical for B Beta-sheet formation and fibrillization, making it a minimal yet potent model for studying tau-driven neurodegeneration. When assembled into pre-formed fibrils (PFFs), Tau dGAE adopts structural features that closely mimic those found in Alzheimer's disease (AD) brain-derived tau aggregates. These AD-mimic PFFs exhibit high seeding efficiency, inducing endogenous tau misfolding and aggregation in cellular and animal models. Their ability to replicate key aspects of tau pathology-including filament morphology, phosphorylation patterns, and neurotoxicity-makes them a powerful tool for mechanistic studies. Tau dGAE AD-mimic PFFs enable researchers to investigate the prion-like propagation of tau aggregates, synaptic dysfunction, and neuronal loss. Their reproducibility and disease relevance support high-throughput screening of anti-tau therapeutics, including aggregation inhibitors, immunotherapies, and modulators of tau clearance pathways. By modeling the structural and functional hallmarks of tau pathology, Tau dGAE AD-mimic PFFs accelerate translational research aimed at halting tau-mediated neurodegeneration. Their use bridges the gap between in vitro biophysics and in vivo disease modeling, offering a robust platform for therapeutic development in Alzheimer's disease and related tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold - i.e. an AD-isolated Tau filaments' fold is distinct from a CTE-isolated Tau filaments' fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq's Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).
Immunogen:
Tau dGAE (297-391) AD-mimic PFFs
Molecular Weight:
10.165 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
MIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
TEM of Tau dGAE AD-mimic fibrils (SPR-502) generated from Tau dGAE monomers (SPR-501) by shaking 200 rpm at 37oC for 48 hours in 10 mM PB 10 mM DTT pH 7.4 with 200 mM MgCl2 added (Lovestam et al. 2022, eLife). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
SDS-PAGE of Tau dGAE AD-mimic fibrils (SPR-502) on a 12% Tris-Glycine Gel.
TEM of Tau dGAE AD-mimic fibrils (SPR-502). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 500 nm.
TEM of Tau dGAE AD-mimic fibrils (SPR-502). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.