Tau dGAE (297-391) AD-mimic Pre-formed Fibrils
Product Sizes
100 ug
SPR-502-100UG
2 x 100 ug
SPR-502-2X100UG
500 ug
SPR-502-500UG
About this Product
- SKU:
- SPR-502
- Additional Names:
- Tau dGAE, Tau 297-391, Truncated Tau, Tau fragment 297-391, microtubule-associated tau, MAPT, MAP, Tau-441, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, Tau PFFs
- Application:
- Cell-based/Functional Assay, Western Blot
- Buffer:
- 10mM PB pH 7.4, 10mM DTT, 200mM MgCl2
- CE/IVD:
- RUO
- Extra Details:
- Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer's disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold - i.e. an AD-isolated Tau filaments' fold is distinct from a CTE-isolated Tau filaments' fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq's catalog# SPR-502 Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).
- Immunogen:
- Tau dGAE (297-391) AD-mimic PFFs
- Molecular Weight:
- 10.165 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-dgae-297-391-ad-mimic-pre-formed-fibrils-spr-502/








