Tau dGAE (297-391) Monomers
Product Sizes
100 ug
SPR-501-100UG
2 x 100 ug
SPR-501-2X100UG
500 ug
SPR-501-500UG
About this Product
- SKU:
- SPR-501
- Additional Names:
- Tau dGAE, Tau 297-391, Truncated Tau, Tau fragment 297-391, microtubule-associated tau, MAPT, MAP, Tau-441, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit
- Application:
- Cell-based/Functional Assay, Western Blot
- Buffer:
- 10mM PB pH 7.4, 10mM DTT
- CE/IVD:
- RUO
- Extra Details:
- Tau dGAE (297-391) is a truncated fragment of the microtubule-associated protein tau (MAPT), encompassing the core region of the protein's aggregation-prone domain. This segment includes key residues involved in B Beta-sheet formation and fibrillization, making it a minimal yet potent model for studying tau aggregation mechanisms. In its monomeric form, Tau dGAE retains the intrinsic disorder and conformational flexibility characteristic of full-length tau, while eliminating regions that complicate structural analysis. This streamlined construct enables researchers to investigate the early molecular events that drive tau misfolding, nucleation, and transition into pathological aggregates observed in tauopathies such as Alzheimer's disease, progressive supranuclear palsy, and corticobasal degeneration. Tau dGAE monomers are particularly valuable for in vitro studies, offering reproducible behavior in aggregation assays and facilitating high-resolution structural characterization. Their use has advanced understanding of the physicochemical properties governing tau self-assembly, including the role of hydrophobic interactions, charge distribution, and post-translational modifications. By modeling the aggregation core of tau, dGAE monomers serve as a foundational tool for screening anti-aggregation compounds, elucidating tau-mediated cytotoxicity, and developing targeted therapeutics. Their application accelerates translational research aimed at disrupting tau pathology and restoring neuronal function in neurodegenerative diseases. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold - i.e. an AD-isolated Tau filaments' fold is distinct from a CTE-isolated Tau filaments' fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5).StressMarq's Tau (297-391) dGAE monomers are purified following these exact published procedures and can be utilized to form these distinct folds using specific aggregation conditions.
- Immunogen:
- Tau dGAE (297-391) Monomers
- Molecular Weight:
- 10.165 kDa
- Purity:
- >95%
- Purification:
- Ion-exchange, ammonium sulfate precipitation and SEC purified
- Sequence:
- MIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-dgae-297-391-monomers-spr-501/




