Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Alpha Synuclein S87N Mutant Pre-formed Fibrils

Product Sizes
500 ug
£1470.00
SPR-500XE-500UG
About this Product
SKU:
SPR-500XE
Additional Names:
Alpha Synuclein S87N, Alpha-synuclein, Alpha synuclein, SNCA, synuclein, NACP, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, SYN, Parkinson's disease familial 1 Protein, Asyn, Alpha Synuclein PFFs
Application:
Cell-based/Functional Assay, Western Blot
Buffer:
1X PBS pH 7.4
CE/IVD:
RUO
Extra Details:
Alpha-synuclein (A Alpha-synuclein), encoded by the SNCA gene, is a neuronal protein central to synaptic vesicle trafficking and neurotransmitter release. The S87N mutation, located within the non-amyloid-B Beta component (NAC) domain, alters the protein's aggregation behavior and membrane interactions-key factors in the pathogenesis of synucleinopathies such as Parkinson's disease and dementia with Lewy bodies. Pre-formed fibrils (PFFs) generated from the S87N mutant exhibit distinct structural and biochemical properties compared to wild-type A Alpha-synuclein fibrils. These mutant PFFs demonstrate enhanced seeding capacity and altered propagation dynamics, making them potent inducers of pathological aggregation in cellular and animal models. Upon internalization, S87N PFFs trigger endogenous A Alpha-synuclein misfolding, leading to the formation of Lewy body-like inclusions, synaptic dysfunction, and neurodegeneration. The S87N mutant PFFs serve as a powerful tool for modeling early and progressive stages of A Alpha-synuclein-driven neurodegeneration. Their use enables precise dissection of molecular mechanisms underlying protein misfolding, prion-like transmission, and neuroinflammatory responses. Furthermore, they provide a robust platform for evaluating therapeutic strategies aimed at inhibiting fibril formation, blocking intercellular spread, and restoring neuronal function. By replicating disease-relevant pathology, Alpha-Synuclein S87N mutant PFFs accelerate translational research and drug discovery efforts targeting the molecular drivers of Parkinson's disease and related disorders. Human alpha synuclein S87N mutant (HuS87N) has Ser87 mutated to the equivalent mouse residue Asn87, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse A Alpha-syn (MsWT) is faster than wild-type human A Alpha-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse A Alpha-syn pathology (1). A53T or S87N substitutions in human A Alpha-syn substantially accelerate fibrilization rates in vitro (2,3). Chimeric HuS87N fibrils show enhanced induction of A Alpha-syn pathology greater than both HuWT and MsWT fibrils in mice neuron cultures (4). Therefore, HuS87N is a good construct for inducing robust endogenous A Alpha-syn seeding and pathology in wild-type mice/cultures.
Immunogen:
Alpha Synuclein S87N PFFs
Molecular Weight:
14.46 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins