Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Tau-441 (2N4R) and Alpha Synuclein Co-Polymer Fibrils

Product Sizes
100 ug
SPR-495-100UG
2 x 100 ug
SPR-495-2X100UG
5 x 100 ug
SPR-495-5X100UG
About this Product
SKU:
SPR-495
Additional Names:
MAPT, 2N4R, Tau40, neurofibrillary tangle, paired-helical filament, PHFs, SNCA, NACP, PARK1, asyn, alpha-synuclein, PFFs, mixed fibrils
Application:
Cell-based/Functional Assay, SDS-PAGE, Western Blot
Buffer:
1X PBS pH 7.4
CE/IVD:
RUO
Concentration:
2 mg/ml
Extra Details:
Tau and alpha-synuclein are two intrinsically disordered proteins central to the pathology of Alzheimer's disease, Parkinson's disease, and other neurodegenerative disorders. Tau stabilizes microtubules in neurons, while alpha-synuclein regulates synaptic vesicle trafficking. Under pathological conditions, both proteins misfold and aggregate, forming fibrils that disrupt cellular function. The 2N4R isoform of tau is expressed in adult brain yet is absent from the fetal brain. Recent studies have revealed that Tau and alpha-synuclein can co-assemble into hybrid structures known as co-polymer fibrils. These fibrils exhibit distinct biophysical properties compared to their individual counterparts, including enhanced stability, altered morphology, and increased neurotoxicity. Their formation suggests a mechanistic link between tauopathies and synucleinopathies, providing insight into overlapping clinical features observed in mixed pathologies such as Alzheimer's disease with Lewy bodies. Tau/alpha-synuclein co-polymer fibrils are used in experimental models to investigate cross-seeding dynamics, prion-like propagation, and synergistic neurodegenerative mechanisms. Their relevance to human disease makes them valuable tools for evaluating therapeutic strategies aimed at disrupting pathological protein interactions, inhibiting co-aggregation, and enhancing clearance. By modeling the convergence of two major proteinopathies, Tau and alpha-synuclein co-polymer fibrils offer a high-impact platform for advancing neurodegenerative disease research and accelerating the development of targeted, multi-pathway interventions.
Immunogen:
Tau & Alpha Synuclein Co-Polymer Fibrils
Molecular Weight:
2N4R: 45.84 kDa, ASYN: 14.46 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
Tau: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL Asyn: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
TEM of Tau 2N4R & Alpha Synuclein Co-Polymer Fibrils (SPR-495). Negative stain transmission electron microscopy images of SPR-495 acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.
Immuno-TEM of Tau & Alpha Synuclein Co-Polymer Fibrils. Fibrils absorbed onto carbon- coated copper grids. Grids were blocked with 1% BSA and 0.1% Tween-20 in PBS, incubated sequentially with primary antibodies at 20 ug/mL in blocking buffer, washed, then incubated with secondary antibodies at 20 ug/mL in blocking buffer, washed and stained with 2% uranyl acetate as a negative stain. 6nm (asyn) and 12nm (tau) signals only appear together in the same fibril strand for the co-polymer fibril samples, and no antibody cross reactivity is observed in control alpha-synuclein or tau fibrils. Primary antibodies: Mouse anti-human asyn monoclonal (StressMarq SMC-532) and rabbit anti-human tau polyclonal (StressMarq SPC-802); Secondary antibodies: 6nm Colloidal Gold-conjugated Goat Anti-Mouse (Jackson ImmunoResearch 115-195- 146) and 12nm Colloidal Gold-conjugated Goat Anti-Rabbit (Jackson ImmunoResearch 111-205-144).
Bis-Tris SDS-PAGE (12%) of Tau 2N4R & Alpha Synuclein Co-Polymer Fibrils. MW ladder = Precision Plus Protein All Blue pre-stained standards.
In vitro Seeding activity of Tau 2N4R & Alpha Synuclein Co-Polymer Fibrils in ThT Assay. Tau 2N4R and Alpha Synuclein co-polymer fibrils seed fibril formation of both Alpha Synuclein monomers and of a mixture of Alpha Synuclein and Tau 2N4R monomers over 72 hours. Reactions (100uL) shaken at 600 rpm in Greiner-Bio 96 Well Non-Binding Cell Culture Microplates, Black (Greiner-Bio Catalog #655900) at 37°C and read with an XPS Microplate Reader set at 450nmex/485nmem.