Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Tau-352 (0N3R) and Alpha Synuclein Co-Polymer Fibrils

Product Sizes
100 ug
SPR-494-100UG
2 x 100 ug
SPR-494-2X100UG
5 x 100 ug
SPR-494-5X100UG
About this Product
SKU:
SPR-494
Additional Names:
MAPT, Tau, Tau40, Fetal Tau, 0N3R, neurofibrillary tangle, paired-helical filament, PHFs, SNCA, NACP, PARK1, asyn, alpha-synuclein, PFFs, mixed fibrils
Application:
Cell-based/Functional Assay, SDS-PAGE, Western Blot
Buffer:
1X PBS pH 7.4
CE/IVD:
RUO
Concentration:
2 mg/ml
Extra Details:
Tau and alpha-synuclein are two key proteins implicated in neurodegenerative diseases such as Alzheimer's disease, Parkinson's disease, and other tauopathies and synucleinopathies. Tau, encoded by the MAPT gene, stabilizes microtubules in neurons, while alpha-synuclein, encoded by SNCA, regulates synaptic vesicle trafficking and neurotransmitter release. Brain-specific tau isoforms vary in the number of N-terminal inserts and C- terminal repeat domains due to alternative splicing of exons; only the shortest isoform of tau, 0N3R, is expressed in the fetal brain during neurogenesis. Under pathological conditions, both proteins misfold and aggregate into fibrillar structures. Recent research has revealed that tau and alpha-synuclein can co-assemble into hybrid fibrils-known as co-polymer fibrils-exhibiting unique structural and biochemical properties distinct from their individual aggregates. These co-polymer fibrils demonstrate enhanced stability, seeding capacity, and neurotoxicity, suggesting a synergistic role in accelerating disease progression. Tau/alpha-synuclein co-polymer fibrils are increasingly used in experimental models to study cross-seeding mechanisms, prion-like propagation, and the convergence of proteinopathies. Their ability to mimic mixed pathologies observed in patients with overlapping clinical features, such as dementia with Lewy bodies and Alzheimer's disease, makes them a powerful tool for translational research. These hybrid fibrils support the development of targeted therapies aimed at disrupting pathological protein interactions, inhibiting co-aggregation, and enhancing clearance mechanisms. By modeling the complex interplay between tau and alpha-synuclein, co-polymer fibrils provide a high-impact platform for advancing understanding of multifactorial neurodegenerative diseases.
Immunogen:
Tau & Alpha Synuclein Co-Polymer Fibrils
Molecular Weight:
0N3R: 36.76 kDa, ASYN: 14.46 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
Tau: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL Asyn: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
TEM of Fetal Tau 0N3R & Alpha Synuclein Co-Polymer Fibrils (SPR-494). Negative stain transmission electron microscopy images of SPR-494 acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.
Immuno-TEM of Tau & Alpha Synuclein Co-Polymer Fibrils. Fibrils absorbed onto carbon- coated copper grids. Grids were blocked with 1% BSA and 0.1% Tween-20 in PBS, incubated sequentially with primary antibodies at 20 ug/mL in blocking buffer, washed, then incubated with secondary antibodies at 20 ug/mL in blocking buffer, washed and stained with 2% uranyl acetate as a negative stain. 6nm (asyn) and 12nm (tau) signals only appear together in the same fibril strand for the co-polymer fibril samples, and no antibody cross reactivity is observed in control alpha-synuclein or tau fibrils. Primary antibodies: Mouse anti-human asyn monoclonal (StressMarq SMC-532) and rabbit anti-human tau polyclonal (StressMarq SPC-802); Secondary antibodies: 6nm Colloidal Gold-conjugated Goat Anti-Mouse (Jackson ImmunoResearch 115-195- 146) and 12nm Colloidal Gold-conjugated Goat Anti-Rabbit (Jackson ImmunoResearch 111-205-144).
Bis-Tris SDS-PAGE (12%) of Fetal Tau 0N3R & Alpha Synuclein Co-Polymer Fibrils. MW ladder = Precision Plus Protein All Blue pre-stained standards.
In vitro Seeding activity of Fetal Tau 0N3R & Alpha Synuclein Co-Polymer Fibrils in ThT Assay. Tau 0N3R and Alpha Synuclein co-polymer fibrils seed fibril formation of both Alpha Synuclein monomers and of a mixture of Alpha Synuclein and Tau 0N3R monomers over 72 hours. Reactions (100uL) shaken at 600 rpm in Greiner-Bio 96 Well Non-Binding Cell Culture Microplates, Black (Greiner-Bio Catalog #655900) at 37°C and read with an XPS Microplate Reader set at 450nmex/485nmem.