Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils
Product Sizes
100 ug
SPR-492-100UG
2 x 100 ug
SPR-492-2X100UG
5 x 100 ug
SPR-492-5X100UG
About this Product
- SKU:
- SPR-492
- Additional Names:
- pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AB BetaPE3, APP
- Application:
- Cell-based/Functional Assay, Western Blot
- Buffer:
- 10mM HCl with 2% DMSO
- CE/IVD:
- RUO
- Concentration:
- 1 mg/ml
- Extra Details:
- Our Amyloid Beta pyroglutamate 3-42 (pyro AB Beta) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). Our pyro AB Beta3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody. Amyloid beta peptide (AB Beta) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of AB Beta plaques in the brain is considered a hallmark of Alzheimer's disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3). Pyroglutamate AB Beta 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to comprise 15-45% of total amyloid beta deposits in brains of AD patients (4,5). Pyroglutamate AB Beta 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length AB Beta 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8).
- Immunogen:
- Amyloid Beta PFFs: Pyroglutamate
- Molecular Weight:
- 4.3 kDa
- Purity:
- >95%
- Sequence:
- pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/proteins/amyloid-beta-protein-spr-492/





