Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils

Product Sizes
100 ug
SPR-492-100UG
2 x 100 ug
SPR-492-2X100UG
5 x 100 ug
SPR-492-5X100UG
About this Product
SKU:
SPR-492
Additional Names:
AB Beta 3-42, Amyloid beta 3-42, Beta amyloid peptide, Abeta, Abeta peptide, Amyloid beta precursor peptide, APP, pyro abeta, pyro amyloid beta, pyroglutamate amyloid beta, AB BetaPE3, Amyloid Beta PFFs
Application:
Cell-based/Functional Assay, Western Blot
Buffer:
10mM HCl with 2% DMSO
CE/IVD:
RUO
Concentration:
1 mg/ml
Extra Details:
Amyloid beta (AB Beta) peptides, particularly the pyroglutamate-modified variant AB Beta 3-42, are increasingly recognized as key contributors to Alzheimer's disease. This truncated form arises from post-translational modification of AB Beta peptides, where the N-terminal glutamate is cyclized into pyroglutamate, enhancing hydrophobicity, resistance to degradation, and aggregation propensity. Pre-formed fibrils (PFFs) of AB Beta 3-42 replicate the B Beta-sheet-rich architecture of amyloid plaques found in Alzheimer's brains. These fibrils exhibit heightened neurotoxicity compared to full-length AB Beta 1-42, due to their increased stability and ability to seed further aggregation. AB Beta 3-42 PFFs are particularly effective at inducing synaptic dysfunction, neuroinflammation, and neuronal death, making them a powerful model for studying the molecular mechanisms of disease progression. In experimental systems, AB Beta 3-42 PFFs are used to investigate prion-like propagation, cellular uptake, and the impact on neuronal networks. Their relevance to human pathology supports their use in preclinical drug screening, enabling the evaluation of therapeutic agents targeting aggregation, clearance, and neuroprotection. By modeling a highly pathogenic form of AB Beta, pyroglutamate 3-42 PFFs provide a robust and translationally relevant platform for advancing Alzheimer's disease research and accelerating the development of effective interventions. StressMarq's Amyloid Beta Pyroglutamate 3-42 (pyro AB Beta) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). StressMarq's pyro AB Beta3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody.
Immunogen:
Amyloid Beta PFFs: Pyroglutamate
Molecular Weight:
4.3 kDa
Purity:
>95%
Sequence:
pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic
TEM of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 500, 200 and 100 nm (left to right). Method: Samples were prepared for examination in the transmission electron microscope using the 'direct application method' (Doane and Anderson 1987).
AFM of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492). Atomic force microscopy analysis of 1.0 mg/mL samples diluted to 0.1 mg/mL in 2% DMSO + 10 mM HCl, mounted on freshly cleaved mica, washed, dried and analyzed with tapping mode. Representative images are 10 x 10 um x-y (left) and 5 x 5 um x-y (middle) and 2 x 2 um x-y (right), all with a z-range of 6 nm.
Western blot of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492) using anti-amyloid beta 6E10 antibody. Amyloid beta pyroglutamate 3-42 at 160 pmol was run on 4-12% Bis-Tris SDS-PAGE, transferred to nitrocellulose in the presence of 0.02% v/v Tween-20, and blotted with 1:1000 mouse 6E10 primary antibody (Biolegend). Compared to monomers re-suspended in 2% DMSO and immediately run on SDS-PAGE, fibrils show monomer depletion, a signal from 37 kDa upwards and a distinct signal in the stacking gel. MW ladder = Precision Plus Dual Xtra prestained standards.