Tau-352 (fetal 0N3R) Wild-Type Monomers
Product Sizes
100 ug
SPR-490-100UG
2 x 100 ug
SPR-490-2X100UG
500 ug
SPR-490-500UG
About this Product
- SKU:
- SPR-490
- Additional Names:
- Tau, Tau aggregate, microtubule-associated Tau, MAPT, MAP, microtubule-associated, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau fragment, Truncated Tau, Tau-352, 0N3R Tau, fetal Tau
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- 10 mM Hepes pH 7.4, 100 mM NaCl
- CE/IVD:
- RUO
- Extra Details:
- Tau protein, encoded by the MAPT gene (UniProt ID: P10636), is a microtubule-associated protein essential for neuronal stability and axonal transport. The Tau-352 isoform, also known as 0N3R, is a fetal variant composed of three microtubule-binding repeats and lacking N-terminal inserts. This isoform is predominantly expressed during early brain development and is gradually replaced by adult isoforms postnatally. In neurodegenerative disease research, Tau-352 wild-type monomers serve as a critical model for understanding isoform-specific contributions to tauopathies. Although considered less aggregation-prone than longer adult isoforms, 0N3R Tau can still misfold under pathological conditions, initiating early aggregation events that may contribute to disease onset. Its unique structural and functional properties offer insights into how developmental Tau variants influence susceptibility to neurodegeneration. Tau-352 monomers are used in biochemical and cellular assays to study microtubule interactions, phosphorylation dynamics, and conformational changes that precede fibril formation. Their relevance extends to conditions such as Alzheimer's disease and Pick's disease, where altered isoform ratios and post-translational modifications are implicated in disease progression. By modeling the behavior of fetal Tau in both healthy and pathological contexts, Tau-352 wild-type monomers provide a foundational platform for exploring early mechanisms of Tau dysfunction and identifying therapeutic strategies aimed at preserving neuronal integrity.
- Immunogen:
- Tau-352 Monomers
- Molecular Weight:
- 37 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-monomers-spr-490/
