Alpha Synuclein Pre-formed Fibrils
Product Sizes
100 ug
SPR-482-100UG
2 x 100 ug
SPR-482-2X100UG
5 x 100 ug
SPR-482-5X100UG
About this Product
- SKU:
- SPR-482
- Additional Names:
- Alpha-synuclein, Alpha synuclein, Asyn, SNCA, NACP, PARK1, PARK4, PD1, Synuclein alpha, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, Synuclein Alpha-140, SYN, Parkinson's disease familial 1 Protein Protein, Alpha Synuclein PFFs
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- Concentration:
- 2 mg/ml
- Extra Details:
- Alpha-synuclein is a neuronal protein involved in synaptic vesicle trafficking and neurotransmitter release. Under physiological conditions, it exists primarily as a soluble monomer or tetramer. However, under pathological conditions, alpha-synuclein misfolds and aggregates into B Beta-sheet-rich fibrils, forming Lewy bodies and neurites-hallmarks of Parkinson's disease and related synucleinopathies. Pre-formed fibrils (PFFs) generated from recombinant alpha-synuclein replicate key structural and biochemical features of disease-associated aggregates. These fibrils are widely used in experimental models to study the prion-like propagation of alpha-synuclein pathology, including its ability to seed endogenous protein misfolding and spread across interconnected brain regions. Alpha-synuclein PFFs are instrumental in elucidating mechanisms of neurotoxicity, synaptic dysfunction, and neuroinflammation. Their application in cellular and animal models enables high-resolution investigation of disease progression and facilitates the screening of therapeutic agents aimed at inhibiting aggregation, enhancing clearance, or blocking intercellular transmission. By providing a reproducible and disease-relevant platform, alpha-synuclein pre-formed fibrils accelerate the development of targeted interventions and biomarker discovery, making them a cornerstone in translational research for neurodegenerative disorders.
- Immunogen:
- Alpha Synuclein PFFs
- Molecular Weight:
- 14.515 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/alpha-synuclein-protein-spr-482/
