Tau (K18) Delta K280 Mutant Pre-formed Fibrils
Product Sizes
100 ug
SPR-477-100UG
2 x 100 ug
SPR-477-2X100UG
5 x 100 ug
SPR-477-5X100UG
About this Product
- SKU:
- SPR-477
- Additional Names:
- Tau PFFs, Tau PFF, Tau protein Pre-formed Fibrils, Tau aggregates, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 4, tubulin-associated unit, MAPT DeltaK280, D DeltaK280 Tau, K18 delta K280 Tau, truncated D DeltaK280 Tau
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- Concentration:
- 2 mg/ml
- Extra Details:
- Alzheimer's Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The D DeltaK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).
- Immunogen:
- Tau (K18) Delta K280 PFFs
- Molecular Weight:
- ~15 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-protein-spr-477/




