Tau (K18) Delta K280 Mutant Pre-formed Fibrils
Product Sizes
100 ug
SPR-477-100UG
2 x 100 ug
SPR-477-2X100UG
5 x 100 ug
SPR-477-5X100UG
About this Product
- SKU:
- SPR-477
- Additional Names:
- Tau, Tau PFFs, Tau PFF, Tau aggregates, microtubule-associated Tau, MAPT, MAP, microtubule-associated, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 4, tubulin-associated unit, MAPT DeltaK280, K280 deletion Tau, K18 Delta K280 Tau, truncated Delta K280 Tau, Tau PFFs
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- Concentration:
- 2 mg/ml
- Extra Details:
- Tau protein, encoded by the MAPT gene (UniProt ID: P10636), plays a central role in stabilizing microtubules and maintaining neuronal integrity. The K18 fragment of Tau, comprising the four microtubule-binding repeat domains, represents the aggregation-prone core of the full-length protein and is widely used in tauopathy research. The D DeltaK280 mutation, involving the deletion of lysine at position 280, dramatically increases Tau's tendency to misfold and assemble into B Beta-sheet-rich fibrils. Pre-formed fibrils (PFFs) generated from Tau (K18) D DeltaK280 mutant protein closely mimic the structural and biochemical properties of pathological Tau aggregates found in neurodegenerative diseases such as Alzheimer's disease and frontotemporal dementia. These mutant PFFs are instrumental in modeling Tau seeding, propagation, and neurotoxicity in vitro and in vivo. Their reproducibility and disease relevance make them ideal for studying the prion-like behavior of Tau, as well as for evaluating therapeutic strategies aimed at inhibiting aggregation, enhancing clearance, or blocking intercellular transmission. Tau (K18) D DeltaK280 PFFs provide a robust and scalable platform for mechanistic studies, biomarker discovery, and drug development, accelerating progress in the fight against tauopathies and related neurodegenerative disorders.
- Immunogen:
- Tau (K18) Delta K280 PFFs
- Molecular Weight:
- ~15 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-protein-spr-477/
