Tau (K18) Delta K280 Mutant Monomers
Product Sizes
100 ug
SPR-476-100UG
2 x 100 ug
SPR-476-2X100UG
5 x 100 ug
SPR-476-5X100UG
About this Product
- SKU:
- SPR-476
- Additional Names:
- Tau, microtubule-associated Tau, MAPT, MAP, microtubule-associated, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau fragment, MAPT DeltaK280, K280 deletion Tau, K18 Delta K280 Tau, truncated Delta K280 Tau
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Buffer:
- PBS
- CE/IVD:
- RUO
- Concentration:
- 2 mg/ml
- Extra Details:
- Tau protein, encoded by the MAPT gene (UniProt ID: P10636), is essential for stabilizing microtubules and maintaining neuronal integrity. The K18 fragment of Tau comprises the four microtubule-binding repeat domains, representing the aggregation-prone core of the full-length protein. The D DeltaK280 mutation, involving the deletion of lysine at position 280, significantly enhances Tau's aggregation propensity. In its monomeric form, Tau (K18) D DeltaK280 exhibits altered structural dynamics and reduced microtubule affinity, making it a powerful tool for studying the earliest molecular events in tauopathy. These monomers serve as a foundational model for investigating how subtle conformational changes can initiate misfolding, seeding, and neurotoxicity. Tau (K18) D DeltaK280 mutant monomers are widely used in biochemical and cellular assays to explore the transition from native Tau to pathogenic aggregates. Their minimal structure allows for high-resolution analysis of post-translational modifications, protein-protein interactions, and early aggregation kinetics. This model is particularly valuable for identifying therapeutic targets that stabilize Tau or prevent its pathological transformation. By capturing the initial stages of Tau dysfunction, Tau (K18) D DeltaK280 mutant monomers provide a streamlined and disease-relevant platform for advancing neurodegenerative research and accelerating the development of preventative interventions.
- Immunogen:
- Tau (K18) Delta K280 Monomers
- Molecular Weight:
- ~15 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/tau-protein-spr-476/
