Rab5 Protein
Product Sizes
50 ug
£609.00
SPR-121-50UG
100 ug
£1079.00
SPR-121-100UG
About this Product
- SKU:
- SPR-121
- Additional Names:
- Rab5, Rab5A, Ras-related protein Rab-5A, RAS associated protein RAB5A, RAB5A member RAS oncogene family
- Application:
- SDS-PAGE, Western Blot
- Buffer:
- 20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 0.5mM DTT
- CE/IVD:
- Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
- Extra Details:
- Rab5 is a small GTPase of the Ras superfamily that plays a central role in regulating early endocytic trafficking. It cycles between an inactive GDP-bound state and an active GTP-bound state, a process tightly controlled by regulatory proteins such as GEFs, GAPs, and GDIs. In its active form, Rab5 associates with early endosomal membranes, where it recruits effector proteins like EEA1 and Rabaptin-5 to mediate vesicle docking, fusion, and cargo sorting. In neuroscience, Rab5 is essential for maintaining synaptic function and neuronal homeostasis through its regulation of receptor internalization, endosome maturation, and axonal transport. Dysregulation of Rab5 activity has been linked to impaired endosomal trafficking, a hallmark of several neurodegenerative diseases including Alzheimer's and Parkinson's. In Alzheimer's disease, for example, Rab5 overactivation is associated with enlarged early endosomes and disrupted amyloid precursor protein (APP) processing, contributing to amyloid-beta accumulation. Rab5 also plays a role in neurotrophin signaling and synaptic plasticity, making it a key player in both neuronal development and degeneration. Its localization to early endosomes and the plasma membrane makes Rab5 a valuable marker for studying endocytic dysfunction in neurodegenerative models.
- Immunogen:
- Rab5 Protein
- Molecular Weight:
- ~26 kDa
- Purity:
- >90%
- Purification:
- Affinity Purified
- Sequence:
- MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/protein/rab5-protein-spr-121/
