GIP (Pro 3)
Product Sizes
0.5 mg
£451.00
CRB1000715-0.5MG
1 mg
£585.00
CRB1000715-1MG
About this Product
- SKU:
- CRB1000715
- Extra Details:
- Gastric inhibitory peptide (GIP) is a member of the secretin hormone family and plays an important role in the regulation of plasma glucose and insulin secretion. In GIP (Pro 3) the glutamic acid at position 3 has been substituted for a proline.
- Sequence:
- H-YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2
- Shipping Conditions:
- Ambient
