Anti-GPC3 / Glypican-3 Reference Antibody (codrituzumab)
Product Sizes
100 ug
£385.00
CHA050-100UG
1 mg
£965.00
CHA050-1MG
About this Product
- SKU:
- CHA050
- Additional Names:
- codrituzumab|GPC3
- Application:
- Cell-based/Functional Assay, Detection/Quantitation, ELISA, FACS, Flow Cytometry
- Buffer:
- 25mM histidine, 8% sucrose, 0.01% Tween80 pH6.2
- Clonality:
- Recombinant Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Anti-GPC3 / Glypican-3 Reference Antibody (codrituzumab)(CHA050) is expressed from CHO. The heavy chain type is huIgG1, and the light chain type is hukappa. It has a predicted MW of 145.5 kDa.
- Immunogen:
- GPC3 / Glypican-3
- Isotype:
- IgG1
- Physical State:
- Lyophilized
- Purity:
- >95%
- Reactivities:
- Human
- Sequence:
- QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQGLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTAYMELSSLTSEDTAVYYCTRFYSYTYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
- Shipping Conditions:
- Blue Ice
- Specificity:
- GPC3 / Glypican-3
- Storage Conditions:
- 2-8[o]C, -70[o]C Avoid freeze/thaw cycles.
- Supplier:
- Sanyou Biopharmaceuticals
- Type:
- Antibody: Biosimilar Antibody
- Manufacturer's Data Sheet:CHA050
