PlGF
Product Sizes
2 ug
£147.00
M30-019-2UG
5 ug
£271.00
M30-019-5UG
About this Product
- SKU:
- M30-019
- Additional Names:
- Pgf; PlGF; Plgf; AI854365; placental growth factor
- Buffer:
- 25 mM Tris, 75 mM NaCl pH 8.5
- Extra Details:
- Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
- Formulation:
- lyophilized
- Host:
- Rat
- Molecular Weight:
- ~40 kDa
- Purity:
- >95%
- Reactivities:
- Mouse
- Sequence:
- ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C/-70[o]C lyophilized, working aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins