GM-CSF
Product Sizes
2 ug
£116.00
M30-012-2UG
10 ug
£205.00
M30-012-10UG
About this Product
- SKU:
- M30-012
- Additional Names:
- Csf2; Csfgm; GMCSF; Gm-CSf; MGI-IGM
- Buffer:
- 30 mM Tris pH8
- translate.label.attr.clone:
- (#5F28)
- Extra Details:
- GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced in endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. The human and murine molecules are species-specific and exhibit no cross-species reactivity. Recombinant murine GM-CSF is a 14.2 kDa globular protein consisting of 124 amino acids residues.
- Formulation:
- lyophilized
- Host:
- Mouse
- Molecular Weight:
- 14.2 kDa
- Purity:
- >98%
- Reactivities:
- Mouse
- Sequence:
- MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins