SF-20
Product Sizes
500 ug
£5419.00
M10-092-L500-500UG
About this Product
- SKU:
- M10-092-L500
- Additional Names:
- C19orf10; IL25; IL27; SF20; IL27w; R33729_1; EUROIMAGE1875335
- Extra Details:
- Mouse SF20 is a bone marrow stroma-derived growth factor. SF20 is expressed in the bone marrow, spleen stroma cells, resting mononuclear cells, resting CD8+ and CD19+ cells and activated CD8+ T cells. SF20 has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Among SF20's biological activities is stimulation of the proliferation of FDCP2 cells (a mouse factor-dependent hemopoietic cell line) and mouse lymphoid cells.
- Formulation:
- lyophilized
- Molecular Weight:
- 15.8 kDa
- Purity:
- > 98% by SDS-PAGE & HPLC analyses
- Reactivities:
- Mouse
- Sequence:
- MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
