IP-10 (CXCL10)
Product Sizes
500 ug
£3102.00
M10-025-L500-500UG
About this Product
- SKU:
- M10-025-L500
- Additional Names:
- Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
- Extra Details:
- Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
- Formulation:
- lyophilized
- Molecular Weight:
- 8.7 kDa
- Purity:
- > 98% by SDS-PAGE & HPLC analyses
- Reactivities:
- Human, Mouse, Non-human Primate, Rat
- Sequence:
- IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
